CHEBI:15841 - polypeptide

Main

ChEBI Ontology

Automatic Xrefs

Reactions

Pathways

Models

ChEBI Name polypeptide ChEBI ID CHEBI:15841 Definition A peptide containing ten or more amino acid residues. Stars This entity has been manually annotated by the ChEBI Team. Secondary ChEBI IDs CHEBI:8314, CHEBI:14860 Formula C4H6N2O3R2(C2H2NOR)n Roles Classification Chemical Role(s): Bronsted base A molecular entity capable of accepting a hydron from a donor (Bronsted acid). (via organic amino compound ) View more via ChEBI Ontology ChEBI Ontology Outgoing polypeptide (CHEBI:15841) is a macromolecule (CHEBI:33839) polypeptide (CHEBI:15841) is a peptide (CHEBI:16670) Incoming β-endorphin (CHEBI:10415) is a polypeptide (CHEBI:15841) ω-conotoxin GVIA (CHEBI:90630) is a polypeptide (CHEBI:15841) (12R)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone (CHEBI:91669) is a polypeptide (CHEBI:15841) (3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone (CHEBI:92233) is a polypeptide (CHEBI:15841) (4R)-4-[[(2S)-2-[[[2-(1-amino-2-methylbutyl)-4,5-dihydrothiazol-4-yl]-oxomethyl]amino]-4-methyl-1-oxopentyl]amino]-5-[[(2S,3S)-1-[[(3S,6R,9S,12R,15S,18R,21S)-3-(2-amino-2-oxoethyl)-18-(3-aminopropyl)-15-[(2S)-butan-2-yl]-6-(carboxymethyl)-9-(1H-imidazol-5-ylmethyl)-2,5,8,11,14,17,20-heptaoxo-12-(phenylmethyl)-1,4,7,10,13,16,19-heptazacyclopentacos-21-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-oxopentanoic acid (CHEBI:94347) is a polypeptide (CHEBI:15841) (6S)-N-[4-amino-1-[[1-[[4-amino-1-oxo-1-[[6,9,18-tris(2-aminoethyl)-3-(1-hydroxyethyl)-15-(2-methylpropyl)-2,5,8,11,14,17,20-heptaoxo-12-propan-2-yl-1,4,7,10,13,16,19-heptazacyclotricos-21-yl]amino]butan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-1-oxobutan-2-yl]-6-methyloctanamide (CHEBI:226544) is a polypeptide (CHEBI:15841) 2-[2-[2-[[2-[[2-[[2-[[2-[2-[[5-(diaminomethylideneamino)-2-[[2-methyl-2-[[3-methyl-2-[2-[[2-methyl-2-[2-[[2-methyl-2-[[2-methyl-2-[[2-methyl-2-[[1-(2-methyl-3-oxotetradecanoyl)pyrrolidine-2-carbonyl]amino]propanoyl]amino]propanoyl]amino]propanoyl]amino]propanoylamino]propanoyl]amino]propanoylamino]butanoyl]amino]propanoyl]amino]pentanoyl]amino]propanoylamino]-2-methylpropanoyl]amino]acetyl]amino]-2-methylpropanoyl]amino]-2-methylpropanoyl]amino]propanoylamino]propanoylamino]-2-methylpropanoic acid (CHEBI:220924) is a polypeptide (CHEBI:15841) 2-[2-[[2-[[2-[[2-[[2-[2-[[5-(diaminomethylideneamino)-2-[[2-methyl-2-[[3-methyl-2-[2-[[2-methyl-2-[2-[[2-methyl-2-[[2-methyl-2-[[2-methyl-2-[[1-(2-methyl-3-oxotetradecanoyl)pyrrolidine-2-carbonyl]amino]propanoyl]amino]propanoyl]amino]propanoyl]amino]propanoylamino]propanoyl]amino]propanoylamino]butanoyl]amino]propanoyl]amino]pentanoyl]amino]propanoylamino]-2-methylpropanoyl]amino]acetyl]amino]-2-methylpropanoyl]amino]-2-methylpropanoyl]amino]propanoylamino]propanoic acid (CHEBI:227000) is a polypeptide (CHEBI:15841) 2-[[2-[[2-[[2-[[2-[2-[[5-carbamimidamido-2-[[2-methyl-2-[2-[2-[[2-methyl-2-[2-[[4-methyl-2-[[2-methyl-2-[2-[2-[[2-methyl-2-[[2-methyl-2-[[2-methyl-2-[[2-methyl-2-[[1-(2-methyl-3-oxotetradecanoyl)pyrrolidine-2-carbonyl]amino]propanoyl]amino]propanoyl]amino]propanoyl]amino]propanoyl]amino]propanoylamino]propanoylamino]propanoyl]amino]pentanoyl]amino]propanoylamino]propanoyl]amino]propanoylamino]propanoylamino]propanoyl]amino]pentanoyl]amino]propanoylamino]-2-methylpropanoyl]amino]acetyl]amino]-2-methylpropanoyl]amino]-2-methylpropanoyl]amino]propanoic acid (CHEBI:201989) is a polypeptide (CHEBI:15841) N-Ac-Asp-N6-lipoyl-KATIGFEVQEE (CHEBI:60738) is a polypeptide (CHEBI:15841) N-acetyl-Asp-N6-[lipoyl]-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu (CHEBI:60217) is a polypeptide (CHEBI:15841) Streptomyces coelicolor calcium-dependent antibiotic CDA4b (CHEBI:29548) is a polypeptide (CHEBI:15841) abarelix (CHEBI:337298) is a polypeptide (CHEBI:15841) Aborycin (CHEBI:227813) is a polypeptide (CHEBI:15841) Ac-Asp-N6-(4-bromobenzoyl)-KATIGFEVQEE (CHEBI:60225) is a polypeptide (CHEBI:15841) Ac-Asp-N6-(5-chloropentanoyl)-KATIGFEVQEE (CHEBI:60228) is a polypeptide (CHEBI:15841) Ac-Asp-N6-(6-bromohexanoyl)-KATIGFEVQEE (CHEBI:60227) is a polypeptide (CHEBI:15841) Ac-Asp-N6-(chloroacetyl)-KATIGFEVQEE (CHEBI:60229) is a polypeptide (CHEBI:15841) Ac-Asp-N6-(octanoyl)-KATIGFEVQEE (CHEBI:60230) is a polypeptide (CHEBI:15841) Ac-Asp-N6-[(2,2,2-trifluoroethoxy)acetyl]-KATIGFEVQEE (CHEBI:60231) is a polypeptide (CHEBI:15841) Ac-Asp-N6-[(2-iodophenyl)carbonyl]-KATIGFEVQEE (CHEBI:60226) is a polypeptide (CHEBI:15841) Ac-Asp-N6-[(2E)-3-(3-nitrophenyl)prop-2-enoyl]-KATIGFEVQEE (CHEBI:60237) is a polypeptide (CHEBI:15841) Ac-Asp-N6-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-KATIGFEVQEE (CHEBI:60235) is a polypeptide (CHEBI:15841) Ac-Asp-N6-[(2E)-3-(m-tolyl)prop-2-enoyl]-KATIGFEVQEE (CHEBI:60236) is a polypeptide (CHEBI:15841) Ac-Asp-N6-[2,5-bis(trifluoromethyl)benzoyl]-KATIGFEVQEE (CHEBI:60224) is a polypeptide (CHEBI:15841) Ac-Asp-N6-[2-(trifluoromethyl)benzoyl]-KATIGFEVQEE (CHEBI:60221) is a polypeptide (CHEBI:15841) Ac-Asp-N6-[3-(trifluoromethyl)benzoyl]-KATIGFEVQEE (CHEBI:60222) is a polypeptide (CHEBI:15841) Ac-Asp-N6-[4-(trifluoromethyl)benzoyl]-KATIGFEVQEE (CHEBI:60223) is a polypeptide (CHEBI:15841) Ac-Asp-N6-{(2E)-3-[2-(trifluoromethyl)phenyl]prop-2-enoyl}-KATIGFEVQEE (CHEBI:60232) is a polypeptide (CHEBI:15841) Ac-Asp-N6-{(2E)-3-[3-(trifluoromethyl)phenyl]prop-2-enoyl}-KATIGFEVQEE (CHEBI:60233) is a polypeptide (CHEBI:15841) Ac-Asp-N6-{(2E)-3-[4-(trifluoromethyl)phenyl]prop-2-enoyl}-KATIGFEVQEE (CHEBI:60234) is a polypeptide (CHEBI:15841) Ac-Asp-N6-{3-[2-(trifluoromethyl)phenyl]propanoyl}-KATIGFEVQEE (CHEBI:60238) is a polypeptide (CHEBI:15841) Ac-Asp-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu (CHEBI:60244) is a polypeptide (CHEBI:15841) Acidocin J-1132beta (CHEBI:198719) is a polypeptide (CHEBI:15841) Actagardine B (CHEBI:203263) is a polypeptide (CHEBI:15841) Actagardine, oxidised form (CHEBI:199163) is a polypeptide (CHEBI:15841) Actagardine, unoxidised form (CHEBI:207302) is a polypeptide (CHEBI:15841) afamelanotide (CHEBI:136034) is a polypeptide (CHEBI:15841) Aibellin (CHEBI:198973) is a polypeptide (CHEBI:15841) albiglutide (CHEBI:78425) is a polypeptide (CHEBI:15841) amoxicilloyl polylysine (CHEBI:133951) is a polypeptide (CHEBI:15841) Ampullosporin (CHEBI:211249) is a polypeptide (CHEBI:15841) Ampullosporin B (CHEBI:206231) is a polypeptide (CHEBI:15841) Ampullosporin C (CHEBI:200814) is a polypeptide (CHEBI:15841) Ampullosporin D (CHEBI:204549) is a polypeptide (CHEBI:15841) Ampullosporin E1 (CHEBI:199355) is a polypeptide (CHEBI:15841) Ampullosporin E2 (CHEBI:207293) is a polypeptide (CHEBI:15841) Ampullosporin E3 (CHEBI:208742) is a polypeptide (CHEBI:15841) Ampullosporin E4 (CHEBI:217480) is a polypeptide (CHEBI:15841) Amychelin B (CHEBI:222872) is a polypeptide (CHEBI:15841) amyloid-β (CHEBI:64645) is a polypeptide (CHEBI:15841) Anafp (CHEBI:199319) is a polypeptide (CHEBI:15841) Andalusicin A (CHEBI:221853) is a polypeptide (CHEBI:15841) Arthrofactin (CHEBI:80022) is a polypeptide (CHEBI:15841) astressin (CHEBI:76649) is a polypeptide (CHEBI:15841) astressin 2B (CHEBI:90229) is a polypeptide (CHEBI:15841) Atroviridin A (CHEBI:220839) is a polypeptide (CHEBI:15841) Atroviridin B (CHEBI:205368) is a polypeptide (CHEBI:15841) Atroviridin-Catr (CHEBI:216651) is a polypeptide (CHEBI:15841) Azotobactin delta (CHEBI:221270) is a polypeptide (CHEBI:15841) bacitracin A (CHEBI:35862) is a polypeptide (CHEBI:15841) Bavaricin A (CHEBI:206985) is a polypeptide (CHEBI:15841) benzylpenicilloyl polylysine (CHEBI:59297) is a polypeptide (CHEBI:15841) BI-32169 (CHEBI:217298) is a polypeptide (CHEBI:15841) bivalirudin (CHEBI:59173) is a polypeptide (CHEBI:15841) Bogorol A (CHEBI:206795) is a polypeptide (CHEBI:15841) Bonsecamin (CHEBI:222280) is a polypeptide (CHEBI:15841) Burrioplantin A (CHEBI:216162) is a polypeptide (CHEBI:15841) Cacaoidin (CHEBI:213170) is a polypeptide (CHEBI:15841) calcitonin (CHEBI:3306) is a polypeptide (CHEBI:15841) calcitonin (human synthetic) (CHEBI:135973) is a polypeptide (CHEBI:15841) calcitonin (pork natural) (CHEBI:135917) is a polypeptide (CHEBI:15841) calpastatin peptide Ac 184-210 (CHEBI:131884) is a polypeptide (CHEBI:15841) carperitide (CHEBI:135914) is a polypeptide (CHEBI:15841) Catenulipeptin (CHEBI:204391) is a polypeptide (CHEBI:15841) cathelicidin (CHEBI:81578) is a polypeptide (CHEBI:15841) Cerexin B (CHEBI:225194) is a polypeptide (CHEBI:15841) Cerexin-D2 (CHEBI:210785) is a polypeptide (CHEBI:15841) Cerexin-D3 (CHEBI:202298) is a polypeptide (CHEBI:15841) Cerexin-D4 (CHEBI:216996) is a polypeptide (CHEBI:15841) Cervinin 59-acetate (CHEBI:206598) is a polypeptide (CHEBI:15841) Chitinimide A (CHEBI:223121) is a polypeptide (CHEBI:15841) Chitinimide B (CHEBI:223116) is a polypeptide (CHEBI:15841) Chitinimide E (CHEBI:223131) is a polypeptide (CHEBI:15841) Chitinimide F (CHEBI:223137) is a polypeptide (CHEBI:15841) Chrysaibol (CHEBI:198420) is a polypeptide (CHEBI:15841) Chrysospermin A (CHEBI:199532) is a polypeptide (CHEBI:15841) Chrysospermin B (CHEBI:204688) is a polypeptide (CHEBI:15841) Chrysospermin C (CHEBI:199845) is a polypeptide (CHEBI:15841) Chrysospermin D (CHEBI:200805) is a polypeptide (CHEBI:15841) CIGB-300 (CHEBI:83696) is a polypeptide (CHEBI:15841) Cinnamomin (CHEBI:202755) is a polypeptide (CHEBI:15841) Cinnapeptin (CHEBI:221461) is a polypeptide (CHEBI:15841) Citrocin (CHEBI:222918) is a polypeptide (CHEBI:15841) Cittilin A (CHEBI:216125) is a polypeptide (CHEBI:15841) ComXRO-B-2 pheromone (CHEBI:212511) is a polypeptide (CHEBI:15841) Corbomycin (CHEBI:221137) is a polypeptide (CHEBI:15841) corticorelin (CHEBI:136037) is a polypeptide (CHEBI:15841) corticotropin (CHEBI:3892) is a polypeptide (CHEBI:15841) corticotropin-releasing hormone (CHEBI:65311) is a polypeptide (CHEBI:15841) cosyntropin (CHEBI:3901) is a polypeptide (CHEBI:15841) Curvopeptin-2 (CHEBI:225949) is a polypeptide (CHEBI:15841) Curvopeptin-3 (CHEBI:214357) is a polypeptide (CHEBI:15841) Curvopeptin-4 (CHEBI:226573) is a polypeptide (CHEBI:15841) Curvopeptin-5 (CHEBI:203161) is a polypeptide (CHEBI:15841) Curvopeptin-6 (CHEBI:222633) is a polypeptide (CHEBI:15841) Cyanochelin A (CHEBI:222242) is a polypeptide (CHEBI:15841) cyanophycin macromolecule (CHEBI:65318) is a polypeptide (CHEBI:15841) Cypemycin (CHEBI:223760) is a polypeptide (CHEBI:15841) DASKALRSSGMP (CHEBI:90938) is a polypeptide (CHEBI:15841) Daspyromycin A (CHEBI:222608) is a polypeptide (CHEBI:15841) Daspyromycin B (CHEBI:222612) is a polypeptide (CHEBI:15841) Deacyl-GP1416 (CHEBI:222364) is a polypeptide (CHEBI:15841) Deepginsen (CHEBI:220750) is a polypeptide (CHEBI:15841) defensin (CHEBI:82761) is a polypeptide (CHEBI:15841) degarelix (CHEBI:135961) is a polypeptide (CHEBI:15841) Deoxyactagardine B (CHEBI:202650) is a polypeptide (CHEBI:15841) dermaseptin s3(1-16)-NH2 (CHEBI:82640) is a polypeptide (CHEBI:15841) desirudin (CHEBI:140427) is a polypeptide (CHEBI:15841) Divercin V41 (CHEBI:197933) is a polypeptide (CHEBI:15841) DKATIGFEVQEE (CHEBI:60216) is a polypeptide (CHEBI:15841) DSGEGDFLAEGGGVR (CHEBI:132999) is a polypeptide (CHEBI:15841) elcatonin (CHEBI:135916) is a polypeptide (CHEBI:15841) elf18 (CHEBI:73165) is a polypeptide (CHEBI:15841) Endopyrrole B (CHEBI:220471) is a polypeptide (CHEBI:15841) enfuvirtide (CHEBI:608828) is a polypeptide (CHEBI:15841) ENPAVHFFKNIVTPRTP (CHEBI:86312) is a polypeptide (CHEBI:15841) ENPVVAFFKNIVTPRTP (CHEBI:86310) is a polypeptide (CHEBI:15841) ENPVVHFFFNIVTPRTP (CHEBI:86303) is a polypeptide (CHEBI:15841) ENPVVHFFKNIVTPRTP (CHEBI:86237) is a polypeptide (CHEBI:15841) ENPVVHFFYNIVTPRTP (CHEBI:86306) is a polypeptide (CHEBI:15841) Enterocin CRL 35 (CHEBI:220783) is a polypeptide (CHEBI:15841) Enterocin EJ97 (CHEBI:216673) is a polypeptide (CHEBI:15841) Enterolysin A (CHEBI:216235) is a polypeptide (CHEBI:15841) exendin-3 (CHEBI:75469) is a polypeptide (CHEBI:15841) exendin-4 (CHEBI:64073) is a polypeptide (CHEBI:15841) Fabrubactin A (CHEBI:221634) is a polypeptide (CHEBI:15841) Fabrubactin B (CHEBI:221639) is a polypeptide (CHEBI:15841) Faulknamycin (CHEBI:220907) is a polypeptide (CHEBI:15841) Feglymycin (CHEBI:199726) is a polypeptide (CHEBI:15841) Felipeptin A1 (CHEBI:223252) is a polypeptide (CHEBI:15841) Felipeptin A2 (CHEBI:223257) is a polypeptide (CHEBI:15841) FPAWFTKLYPRT (CHEBI:90916) is a polypeptide (CHEBI:15841) FR901451 (CHEBI:227546) is a polypeptide (CHEBI:15841) Fulvocin C (CHEBI:201083) is a polypeptide (CHEBI:15841) Fungal ferritin (CHEBI:225958) is a polypeptide (CHEBI:15841) Fusaoctaxin A (CHEBI:220359) is a polypeptide (CHEBI:15841) Gabetaericin B1 (CHEBI:220157) is a polypeptide (CHEBI:15841) Gabetaericin B3 (CHEBI:219401) is a polypeptide (CHEBI:15841) Gallidermin (CHEBI:221261) is a polypeptide (CHEBI:15841) ganirelix (CHEBI:135910) is a polypeptide (CHEBI:15841) gastrin (CHEBI:75436) is a polypeptide (CHEBI:15841) ghrelin (CHEBI:75431) is a polypeptide (CHEBI:15841) Glomerella cingulata peptide (CHEBI:221357) is a polypeptide (CHEBI:15841) Goadpeptin B (CHEBI:220766) is a polypeptide (CHEBI:15841) Goadvionin A1 (CHEBI:220770) is a polypeptide (CHEBI:15841) Goadvionin A2 (CHEBI:220776) is a polypeptide (CHEBI:15841) Goadvionin A3 (CHEBI:220781) is a polypeptide (CHEBI:15841) Goadvionin A4 (CHEBI:220784) is a polypeptide (CHEBI:15841) Goadvionin B1 (CHEBI:220789) is a polypeptide (CHEBI:15841) Goadvionin B2 (CHEBI:220762) is a polypeptide (CHEBI:15841) Goadvionin B3 (CHEBI:220800) is a polypeptide (CHEBI:15841) Goadvionin B4 (CHEBI:220794) is a polypeptide (CHEBI:15841) Gonadorelin hydrochloride (CHEBI:5521) is a polypeptide (CHEBI:15841) GP6738 (CHEBI:222360) is a polypeptide (CHEBI:15841) Grimoviridin (CHEBI:220665) is a polypeptide (CHEBI:15841) GsMTx4 (CHEBI:194078) is a polypeptide (CHEBI:15841) Haereoplantin A (CHEBI:216132) is a polypeptide (CHEBI:15841) Haereoplantin B (CHEBI:216138) is a polypeptide (CHEBI:15841) Haereoplantin E (CHEBI:216156) is a polypeptide (CHEBI:15841) Halovir I (CHEBI:222701) is a polypeptide (CHEBI:15841) Halovir J (CHEBI:222707) is a polypeptide (CHEBI:15841) Halovir K (CHEBI:222712) is a polypeptide (CHEBI:15841) Harpin (CHEBI:201724) is a polypeptide (CHEBI:15841) Harzianin HC-6 (CHEBI:207111) is a polypeptide (CHEBI:15841) Harzianin PCu 4 (CHEBI:211321) is a polypeptide (CHEBI:15841) Heinamide B2 (CHEBI:221385) is a polypeptide (CHEBI:15841) Heinamide B3 (CHEBI:221389) is a polypeptide (CHEBI:15841) Holrhizin E (CHEBI:223768) is a polypeptide (CHEBI:15841) Holrhizin F (CHEBI:223772) is a polypeptide (CHEBI:15841) Holrhizin G (CHEBI:223778) is a polypeptide (CHEBI:15841) Holrhizin K (CHEBI:223794) is a polypeptide (CHEBI:15841) Holrhizin M (CHEBI:223736) is a polypeptide (CHEBI:15841) Holrhizin N (CHEBI:223741) is a polypeptide (CHEBI:15841) Holrhizin O (CHEBI:223747) is a polypeptide (CHEBI:15841) Holrhizin P (CHEBI:223752) is a polypeptide (CHEBI:15841) Holrhizin Q (CHEBI:223757) is a polypeptide (CHEBI:15841) Huascopeptin (CHEBI:216325) is a polypeptide (CHEBI:15841) Hypelcin B-I (CHEBI:205745) is a polypeptide (CHEBI:15841) Hypelcin B-II (CHEBI:198583) is a polypeptide (CHEBI:15841) Hypelcin B-III (CHEBI:221781) is a polypeptide (CHEBI:15841) Hypelcin B-IV (CHEBI:220229) is a polypeptide (CHEBI:15841) Hypelcin B-V (CHEBI:203475) is a polypeptide (CHEBI:15841) Hypomurocin A-3 (CHEBI:217264) is a polypeptide (CHEBI:15841) Hypomurocin A-4 (CHEBI:203304) is a polypeptide (CHEBI:15841) Hypomurocin A-5 (CHEBI:204071) is a polypeptide (CHEBI:15841) Hypomurocin A-5a (CHEBI:223654) is a polypeptide (CHEBI:15841) Hypomurocin B-1 (CHEBI:207920) is a polypeptide (CHEBI:15841) Hypomurocin B-2 (CHEBI:215502) is a polypeptide (CHEBI:15841) Hypomurocin B-3a (CHEBI:198678) is a polypeptide (CHEBI:15841) Hypomurocin B-3b (CHEBI:214858) is a polypeptide (CHEBI:15841) Hypomurocin B-4 (CHEBI:213724) is a polypeptide (CHEBI:15841) Hypomurocin B-5 (CHEBI:224395) is a polypeptide (CHEBI:15841) insulin (CHEBI:145810) is a polypeptide (CHEBI:15841) IPQVWRDWFKLP (CHEBI:90834) is a polypeptide (CHEBI:15841) Iso-faulknamycin (CHEBI:222277) is a polypeptide (CHEBI:15841) JNK inhibitor I (CHEBI:88340) is a polypeptide (CHEBI:15841) KGKGKGKGKGENPAVHFFKNIVTPRTP (CHEBI:86313) is a polypeptide (CHEBI:15841) KGKGKGKGKGENPVVAFFKNIVTPRTP (CHEBI:86311) is a polypeptide (CHEBI:15841) KGKGKGKGKGENPVVHFFFNIVTPRTP (CHEBI:86304) is a polypeptide (CHEBI:15841) KGKGKGKGKGENPVVHFFKNIVTPRTP (CHEBI:86233) is a polypeptide (CHEBI:15841) KGKGKGKGKGENPVVHFFYNIVTPRTP (CHEBI:86307) is a polypeptide (CHEBI:15841) kisspeptin-54 (CHEBI:80304) is a polypeptide (CHEBI:15841) Kolobetain A (CHEBI:219402) is a polypeptide (CHEBI:15841) koshikamide A2 (CHEBI:66149) is a polypeptide (CHEBI:15841) Kyamicin (CHEBI:223091) is a polypeptide (CHEBI:15841) Labetaomycin (CHEBI:198412) is a polypeptide (CHEBI:15841) Lacticin 481 (CHEBI:216136) is a polypeptide (CHEBI:15841) Lactococcin mmfii (CHEBI:209856) is a polypeptide (CHEBI:15841) lantibiotic (CHEBI:71644) is a polypeptide (CHEBI:15841) Lariatin A (CHEBI:201278) is a polypeptide (CHEBI:15841) Lariatin B (CHEBI:199137) is a polypeptide (CHEBI:15841) Laxaphycin B5 (CHEBI:223480) is a polypeptide (CHEBI:15841) Laxaphycin B6 (CHEBI:223486) is a polypeptide (CHEBI:15841) lepirudin (CHEBI:142437) is a polypeptide (CHEBI:15841) Leucinostatin NPDG A (CHEBI:224206) is a polypeptide (CHEBI:15841) Leucinostatin NPDG B (CHEBI:224211) is a polypeptide (CHEBI:15841) Leucocin B-TA33a (CHEBI:202207) is a polypeptide (CHEBI:15841) Leucocin C-TA33a (CHEBI:198688) is a polypeptide (CHEBI:15841) Ling Zhi-8 (CHEBI:209005) is a polypeptide (CHEBI:15841) Linocin M18 (CHEBI:198774) is a polypeptide (CHEBI:15841) liraglutide (CHEBI:71193) is a polypeptide (CHEBI:15841) lixisenatide (CHEBI:85662) is a polypeptide (CHEBI:15841) LP237-F5 (CHEBI:224158) is a polypeptide (CHEBI:15841) LP237-F7 (CHEBI:204703) is a polypeptide (CHEBI:15841) LP237-F8 (CHEBI:218882) is a polypeptide (CHEBI:15841) LSM-37009 (CHEBI:125504) is a polypeptide (CHEBI:15841) LSM-37015 (CHEBI:125509) is a polypeptide (CHEBI:15841) LSM-37045 (CHEBI:125534) is a polypeptide (CHEBI:15841) LSM-37094 (CHEBI:125564) is a polypeptide (CHEBI:15841) LSM-37129 (CHEBI:125587) is a polypeptide (CHEBI:15841) LSM-37138 (CHEBI:125595) is a polypeptide (CHEBI:15841) LSM-37175 (CHEBI:125621) is a polypeptide (CHEBI:15841) LSM-37192 (CHEBI:125634) is a polypeptide (CHEBI:15841) LSM-37213 (CHEBI:125652) is a polypeptide (CHEBI:15841) Lyngbyazothrin A (CHEBI:220562) is a polypeptide (CHEBI:15841) Lyngbyazothrin B (CHEBI:202331) is a polypeptide (CHEBI:15841) Lyngbyazothrin C (CHEBI:210924) is a polypeptide (CHEBI:15841) Lyngbyazothrin D (CHEBI:202610) is a polypeptide (CHEBI:15841) Marinomonasin (CHEBI:221551) is a polypeptide (CHEBI:15841) Marinostatin (CHEBI:221095) is a polypeptide (CHEBI:15841) mastoparans (CHEBI:78506) is a polypeptide (CHEBI:15841) melittin (CHEBI:6736) is a polypeptide (CHEBI:15841) Michiganin A (CHEBI:200403) is a polypeptide (CHEBI:15841) Microcin J25 (CHEBI:203056) is a polypeptide (CHEBI:15841) Microviridin C (CHEBI:207756) is a polypeptide (CHEBI:15841) Microviridin D (CHEBI:203309) is a polypeptide (CHEBI:15841) Microviridin E (CHEBI:214901) is a polypeptide (CHEBI:15841) Microviridin F (CHEBI:211876) is a polypeptide (CHEBI:15841) Microviridin H (CHEBI:211599) is a polypeptide (CHEBI:15841) Microviridin SD-1684 (CHEBI:204978) is a polypeptide (CHEBI:15841) Mirabamide C (CHEBI:68407) is a polypeptide (CHEBI:15841) Mirabamide G (CHEBI:68405) is a polypeptide (CHEBI:15841) Mirabamide H (CHEBI:68406) is a polypeptide (CHEBI:15841) Misaugamycin A (CHEBI:222477) is a polypeptide (CHEBI:15841) Misaugamycin B (CHEBI:222483) is a polypeptide (CHEBI:15841) Myxarylin (CHEBI:222409) is a polypeptide (CHEBI:15841) N-[4-amino-1-[[1-[[4-amino-1-oxo-1-[[6,9,18-tris(2-aminoethyl)-3-(1-hydroxyethyl)-15-(2-methylpropyl)-2,5,8,11,14,17,20-heptaoxo-12-propan-2-yl-1,4,7,10,13,16,19-heptazacyclotricos-21-yl]amino]butan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-1-oxobutan-2-yl]-6-methylheptanamide (CHEBI:203023) is a polypeptide (CHEBI:15841) Neoatroviridin A (CHEBI:225592) is a polypeptide (CHEBI:15841) Neoatroviridin B (CHEBI:202975) is a polypeptide (CHEBI:15841) Neoatroviridin D (CHEBI:205376) is a polypeptide (CHEBI:15841) nesiritide (CHEBI:135919) is a polypeptide (CHEBI:15841) Neurokinin A (CHEBI:80311) is a polypeptide (CHEBI:15841) Neurokinin B (CHEBI:80312) is a polypeptide (CHEBI:15841) Nisin Z (CHEBI:201790) is a polypeptide (CHEBI:15841) Nocathioamide A (CHEBI:222049) is a polypeptide (CHEBI:15841) Nocathioamide B (CHEBI:222055) is a polypeptide (CHEBI:15841) Nocathioamide C (CHEBI:222059) is a polypeptide (CHEBI:15841) nociceptin (CHEBI:80266) is a polypeptide (CHEBI:15841) P-factor (CHEBI:64121) is a polypeptide (CHEBI:15841) p-Glu-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe (CHEBI:138186) is a polypeptide (CHEBI:15841) PA48009 (CHEBI:219659) is a polypeptide (CHEBI:15841) Paenithopeptin A (CHEBI:222487) is a polypeptide (CHEBI:15841) Paenithopeptin B (CHEBI:222492) is a polypeptide (CHEBI:15841) Paenithopeptin C (CHEBI:222497) is a polypeptide (CHEBI:15841) Paenithopeptin D (CHEBI:222500) is a polypeptide (CHEBI:15841) Paenithopeptin E (CHEBI:222504) is a polypeptide (CHEBI:15841) Paracelsin E (CHEBI:205710) is a polypeptide (CHEBI:15841) Parasiticein (CHEBI:207872) is a polypeptide (CHEBI:15841) penicilloyl polylysine (CHEBI:78855) is a polypeptide (CHEBI:15841) peptide YY (CHEBI:80330) is a polypeptide (CHEBI:15841) Pholipeptin (CHEBI:204572) is a polypeptide (CHEBI:15841) Piscicolin-61 (CHEBI:205050) is a polypeptide (CHEBI:15841) Planosporicin (CHEBI:226796) is a polypeptide (CHEBI:15841) Plantaricin W (CHEBI:224729) is a polypeptide (CHEBI:15841) Plw-alpha (CHEBI:224578) is a polypeptide (CHEBI:15841) POH 1 (CHEBI:222439) is a polypeptide (CHEBI:15841) POH 2 (CHEBI:203289) is a polypeptide (CHEBI:15841) POH 3 (CHEBI:212304) is a polypeptide (CHEBI:15841) poly(glycyl-L-arginine) (CHEBI:142891) is a polypeptide (CHEBI:15841) Polymyxin B1 Sulfate (CHEBI:201575) is a polypeptide (CHEBI:15841) Polymyxin B5 (CHEBI:211004) is a polypeptide (CHEBI:15841) Polymyxin B6 (CHEBI:209565) is a polypeptide (CHEBI:15841) Polymyxin E4 (CHEBI:203101) is a polypeptide (CHEBI:15841) Polymyxin E7 (CHEBI:226835) is a polypeptide (CHEBI:15841) Polymyxin Ile-E8 (CHEBI:218341) is a polypeptide (CHEBI:15841) Polymyxin Nva-E1 (CHEBI:207083) is a polypeptide (CHEBI:15841) Polymyxin Nva-E2 (CHEBI:226672) is a polypeptide (CHEBI:15841) Polymyxin-P1 (CHEBI:212443) is a polypeptide (CHEBI:15841) Polysporin A (CHEBI:206605) is a polypeptide (CHEBI:15841) Polysporin B (CHEBI:200846) is a polypeptide (CHEBI:15841) Polysporin C (CHEBI:211819) is a polypeptide (CHEBI:15841) Polysporin D (CHEBI:215992) is a polypeptide (CHEBI:15841) Polytheonamide A (CHEBI:220309) is a polypeptide (CHEBI:15841) Polytheonamide B (CHEBI:220315) is a polypeptide (CHEBI:15841) Potashchelin A (CHEBI:221487) is a polypeptide (CHEBI:15841) Potashchelin B (CHEBI:221491) is a polypeptide (CHEBI:15841) Potashchelin C (CHEBI:221496) is a polypeptide (CHEBI:15841) Potashchelin D (CHEBI:221500) is a polypeptide (CHEBI:15841) pramlintide (CHEBI:135922) is a polypeptide (CHEBI:15841) Pristinin A3 (CHEBI:220917) is a polypeptide (CHEBI:15841) Propeptin (CHEBI:205248) is a polypeptide (CHEBI:15841) Propeptin-2 (CHEBI:200888) is a polypeptide (CHEBI:15841) protein polypeptide chain (CHEBI:16541) is a polypeptide (CHEBI:15841) Prunipeptin (CHEBI:221856) is a polypeptide (CHEBI:15841) Pseudoalteropeptide A (CHEBI:223586) is a polypeptide (CHEBI:15841) Pseudodesmin C (CHEBI:213273) is a polypeptide (CHEBI:15841) Pseudovibriamide A1 (CHEBI:222002) is a polypeptide (CHEBI:15841) Pseudovibriamide A3 (CHEBI:222011) is a polypeptide (CHEBI:15841) Pseudovibriamide A5 (CHEBI:222018) is a polypeptide (CHEBI:15841) Pseudovibriamide A6 (CHEBI:222023) is a polypeptide (CHEBI:15841) QINTAKWWKTHF (CHEBI:90925) is a polypeptide (CHEBI:15841) QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 (CHEBI:84736) is a polypeptide (CHEBI:15841) Quinoisobutyride A (CHEBI:214815) is a polypeptide (CHEBI:15841) Rac1 Inhibitor W56 (CHEBI:167451) is a polypeptide (CHEBI:15841) RES-701-2 (CHEBI:201913) is a polypeptide (CHEBI:15841) RES-701-3 (CHEBI:201308) is a polypeptide (CHEBI:15841) RES-701-4 (CHEBI:203709) is a polypeptide (CHEBI:15841) Rimomycin A (CHEBI:222464) is a polypeptide (CHEBI:15841) Rimomycin B (CHEBI:222468) is a polypeptide (CHEBI:15841) Rimomycin C (CHEBI:222473) is a polypeptide (CHEBI:15841) Ririwpeptide A (CHEBI:220609) is a polypeptide (CHEBI:15841) Ririwpeptide B (CHEBI:220614) is a polypeptide (CHEBI:15841) Rotihibin C (CHEBI:222246) is a polypeptide (CHEBI:15841) Rotihibin D (CHEBI:222251) is a polypeptide (CHEBI:15841) Sakacin 674 (CHEBI:199746) is a polypeptide (CHEBI:15841) Salivaricin B (CHEBI:198489) is a polypeptide (CHEBI:15841) Salivaricin P (CHEBI:221301) is a polypeptide (CHEBI:15841) Scytocyclamide B (CHEBI:223034) is a polypeptide (CHEBI:15841) Scytocyclamide B2 (CHEBI:220729) is a polypeptide (CHEBI:15841) Scytocyclamide B3 (CHEBI:220734) is a polypeptide (CHEBI:15841) Scytocyclamide C (CHEBI:223039) is a polypeptide (CHEBI:15841) Scytovirin (CHEBI:220189) is a polypeptide (CHEBI:15841) secretin human (CHEBI:135913) is a polypeptide (CHEBI:15841) semaglutide (CHEBI:167574) is a polypeptide (CHEBI:15841) Septocylindrin A (CHEBI:217989) is a polypeptide (CHEBI:15841) Septocylindrin B (CHEBI:215471) is a polypeptide (CHEBI:15841) sermorelin (CHEBI:9118) is a polypeptide (CHEBI:15841) SN50 (CHEBI:195371) is a polypeptide (CHEBI:15841) SPF-5506-A4 (CHEBI:216846) is a polypeptide (CHEBI:15841) STAT3 inhibitor peptide (CHEBI:90286) is a polypeptide (CHEBI:15841) Streptamidine (CHEBI:220962) is a polypeptide (CHEBI:15841) Streptomonomicin (CHEBI:200727) is a polypeptide (CHEBI:15841) Streptosactin (CHEBI:220844) is a polypeptide (CHEBI:15841) Sungsanpin (CHEBI:227706) is a polypeptide (CHEBI:15841) Syringafactin A (CHEBI:220020) is a polypeptide (CHEBI:15841) Syringafactin B (CHEBI:220028) is a polypeptide (CHEBI:15841) Syringafactin C (CHEBI:220023) is a polypeptide (CHEBI:15841) Syringafactin D (CHEBI:220034) is a polypeptide (CHEBI:15841) Syringafactin F (CHEBI:220042) is a polypeptide (CHEBI:15841) teduglutide (CHEBI:72305) is a polypeptide (CHEBI:15841) teriparatide (CHEBI:135983) is a polypeptide (CHEBI:15841) terlipressin (CHEBI:135905) is a polypeptide (CHEBI:15841) tesamorelin (CHEBI:63626) is a polypeptide (CHEBI:15841) Thanafactin A (CHEBI:222134) is a polypeptide (CHEBI:15841) Thioalbamide (CHEBI:220172) is a polypeptide (CHEBI:15841) Thiostreptamide S4 (CHEBI:220175) is a polypeptide (CHEBI:15841) Thiostreptamide S87 (CHEBI:220180) is a polypeptide (CHEBI:15841) Thuricin 439A (CHEBI:198021) is a polypeptide (CHEBI:15841) thymalfasin (CHEBI:135915) is a polypeptide (CHEBI:15841) tirzepatide (CHEBI:194186) is a polypeptide (CHEBI:15841) Tolybybetaidin A (CHEBI:208959) is a polypeptide (CHEBI:15841) Tolybybetaidin B (CHEBI:198762) is a polypeptide (CHEBI:15841) Trichobrachin-IB (CHEBI:199667) is a polypeptide (CHEBI:15841) Trichobrachin-IIA (CHEBI:208306) is a polypeptide (CHEBI:15841) Trichocellin-A-III (CHEBI:199111) is a polypeptide (CHEBI:15841) Trichocellin-A-IV (CHEBI:199109) is a polypeptide (CHEBI:15841) Trichocellin-A-V (CHEBI:208717) is a polypeptide (CHEBI:15841) Trichocellin-A-VI (CHEBI:213080) is a polypeptide (CHEBI:15841) Trichocellin-A-VII (CHEBI:202024) is a polypeptide (CHEBI:15841) Trichocellin-A-VIII (CHEBI:208931) is a polypeptide (CHEBI:15841) Trichocellin-B-I (CHEBI:210638) is a polypeptide (CHEBI:15841) Trichocellin-B-II (CHEBI:204032) is a polypeptide (CHEBI:15841) Trichogin A IV (CHEBI:202703) is a polypeptide (CHEBI:15841) Trichokindin-Ia (CHEBI:214950) is a polypeptide (CHEBI:15841) Trichokindin-Ib (CHEBI:224092) is a polypeptide (CHEBI:15841) Trichokindin-IIa (CHEBI:217812) is a polypeptide (CHEBI:15841) Trichokindin-IIIb (CHEBI:206921) is a polypeptide (CHEBI:15841) Trichokonin V (CHEBI:225141) is a polypeptide (CHEBI:15841) Trichokonin-Ia (CHEBI:224799) is a polypeptide (CHEBI:15841) Trichokonin-Ib (CHEBI:212009) is a polypeptide (CHEBI:15841) Trichokonin-IX (CHEBI:201035) is a polypeptide (CHEBI:15841) Trichokonin-VII (CHEBI:200735) is a polypeptide (CHEBI:15841) Trichormamide D (CHEBI:200222) is a polypeptide (CHEBI:15841) Trichorovin-IIa (CHEBI:206663) is a polypeptide (CHEBI:15841) Trichorovin-IVb (CHEBI:213954) is a polypeptide (CHEBI:15841) Trichorovin-IXb (CHEBI:201326) is a polypeptide (CHEBI:15841) Trichorovin-Va (CHEBI:199802) is a polypeptide (CHEBI:15841) Trichorovin-Vb (CHEBI:199022) is a polypeptide (CHEBI:15841) Trichorovin-VIIa (CHEBI:205055) is a polypeptide (CHEBI:15841) Trichorovin-XI (CHEBI:203091) is a polypeptide (CHEBI:15841) Trichorovin-XIIa (CHEBI:201032) is a polypeptide (CHEBI:15841) Trichorovin-XIV (CHEBI:210045) is a polypeptide (CHEBI:15841) Trichorozin-III (CHEBI:219648) is a polypeptide (CHEBI:15841) Trichorzianine A IIIC (CHEBI:219430) is a polypeptide (CHEBI:15841) Trichorzin HA-1 (CHEBI:217056) is a polypeptide (CHEBI:15841) Trichorzin HA-2 (CHEBI:213923) is a polypeptide (CHEBI:15841) Trichorzin HA-3 (CHEBI:221023) is a polypeptide (CHEBI:15841) Trichorzin HA-5 (CHEBI:220852) is a polypeptide (CHEBI:15841) Trichorzin HA-6 (CHEBI:203556) is a polypeptide (CHEBI:15841) Trichorzin HA-7 (CHEBI:204532) is a polypeptide (CHEBI:15841) Trichorzin MA-1 (CHEBI:198767) is a polypeptide (CHEBI:15841) Trichorzin MA-2 (CHEBI:219088) is a polypeptide (CHEBI:15841) Trichorzin MA-3 (CHEBI:210730) is a polypeptide (CHEBI:15841) Trichorzin PA IV (CHEBI:204419) is a polypeptide (CHEBI:15841) Trichorzin PA IX (CHEBI:201981) is a polypeptide (CHEBI:15841) Trichorzin PA V (CHEBI:213714) is a polypeptide (CHEBI:15841) Trichorzin PA VI (CHEBI:202120) is a polypeptide (CHEBI:15841) Trichorzin PA VII (CHEBI:201856) is a polypeptide (CHEBI:15841) Trichorzin PA VIII (CHEBI:200806) is a polypeptide (CHEBI:15841) Trichorzin PAu 4 (CHEBI:204958) is a polypeptide (CHEBI:15841) Trichovirin II 1a (CHEBI:226370) is a polypeptide (CHEBI:15841) Trichovirin II 1b (CHEBI:214028) is a polypeptide (CHEBI:15841) Trichovirin II 2a (CHEBI:221304) is a polypeptide (CHEBI:15841) Trichovirin II 2b (CHEBI:208591) is a polypeptide (CHEBI:15841) Trichovirin II 2c (CHEBI:220629) is a polypeptide (CHEBI:15841) Trichovirin II 3a (CHEBI:205393) is a polypeptide (CHEBI:15841) Trichovirin II 3b (CHEBI:213750) is a polypeptide (CHEBI:15841) Trichovirin II 4a (CHEBI:215040) is a polypeptide (CHEBI:15841) Trichovirin II 4b (CHEBI:214497) is a polypeptide (CHEBI:15841) Trichovirin II 5 (CHEBI:198734) is a polypeptide (CHEBI:15841) Trichovirin II 6a (CHEBI:198587) is a polypeptide (CHEBI:15841) Trichovirin II 6b (CHEBI:202285) is a polypeptide (CHEBI:15841) Tridecaptin A1 (CHEBI:219409) is a polypeptide (CHEBI:15841) Tridecaptin M (CHEBI:220644) is a polypeptide (CHEBI:15841) Trikoningin-KA-V (CHEBI:199117) is a polypeptide (CHEBI:15841) Tychonamide B (CHEBI:201873) is a polypeptide (CHEBI:15841) Tylopeptin A (CHEBI:204067) is a polypeptide (CHEBI:15841) Tylopeptin B (CHEBI:224667) is a polypeptide (CHEBI:15841) Vaby A (CHEBI:67901) is a polypeptide (CHEBI:15841) Vaby B (CHEBI:67902) is a polypeptide (CHEBI:15841) Vaby C (CHEBI:67903) is a polypeptide (CHEBI:15841) Vaby D (CHEBI:67904) is a polypeptide (CHEBI:15841) Vaby E (CHEBI:67905) is a polypeptide (CHEBI:15841) Variochelin A (CHEBI:220163) is a polypeptide (CHEBI:15841) Variochelin B (CHEBI:220167) is a polypeptide (CHEBI:15841) Varv E (CHEBI:67906) is a polypeptide (CHEBI:15841) Victoricine (CHEBI:221046) is a polypeptide (CHEBI:15841) Victorinine B (CHEBI:213279) is a polypeptide (CHEBI:15841) Victorinine D (CHEBI:213285) is a polypeptide (CHEBI:15841) VSWKTWFPNLAV (CHEBI:90830) is a polypeptide (CHEBI:15841) WHWLQLKPGQPMY (CHEBI:79382) is a polypeptide (CHEBI:15841) YIIKGLFWDPAC (CHEBI:79379) is a polypeptide (CHEBI:15841) YIIKGVFWDPAC (CHEBI:79378) is a polypeptide (CHEBI:15841) YSPFHKWFPSMH (CHEBI:90831) is a polypeptide (CHEBI:15841) IUPAC Name polypeptides Synonyms Sources polipéptido ChEBI Polypeptid ChEBI Polypeptide KEGG COMPOUND Manual Xref Database C00403 KEGG COMPOUND View more database links Last Modified 14 July 2023